PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_36291
Common NameKK1_039596
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 373aa    MW: 42452.1 Da    PI: 4.9452
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_36291genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.68.9e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed++l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
    C.cajan_36291 16 RGPWSPSEDLKLIAFIQKYGHENWRALPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding50.45.1e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+e +++++k lG++ W++Ia+ ++ gRt++++k+ w+++l
    C.cajan_36291  69 RGNFTPKEEETIIRLHKALGNK-WSKIASSLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-24766IPR009057Homeodomain-like
PROSITE profilePS5129413.871163IPR017930Myb domain
SuperFamilySSF466892.13E-2914110IPR009057Homeodomain-like
SMARTSM007172.2E-131565IPR001005SANT/Myb domain
PfamPF002491.2E-141663IPR001005SANT/Myb domain
CDDcd001671.30E-91863No hitNo description
PROSITE profilePS5129424.44964118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2667118IPR009057Homeodomain-like
SMARTSM007172.5E-1468116IPR001005SANT/Myb domain
PfamPF002491.1E-1469114IPR001005SANT/Myb domain
CDDcd001671.87E-971114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MGKGRAPCCD KTQVKRGPWS PSEDLKLIAF IQKYGHENWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDVKRG NFTPKEEETI IRLHKALGNK WSKIASSLPG RTDNEIKNVW NTHLKKRLTA  120
KKCSDSSADE SKPESSITSS SSSSSESFFS NETPNSPKTT TLGNEFNDQA SQVTDKIEQD  180
SDKQVSNELN GIITKDPKES SVSFSSIGSN IVTTSQNVAY KEKQQLASPL SYLGPYDFSS  240
MLEEVDKPNH LFERPWESDF VLWKILRDDS LGSFQSNEVQ LGEFLACQNS ILGEEIVQDV  300
EARKWFHDFE DEFGIVDEIK ESNNDHFLPK NYAVEPEIDH TQTFDFDDIT RPESELDFGY  360
IQLWSSWPQN TSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-27161187108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN8635312e-75JN863531.1 Lotus japonicus R2R3MYB transcription factor (MYB10) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006598214.10.0PREDICTED: LOW QUALITY PROTEIN: myb-related protein Zm1
TrEMBLA0A151R9E50.0A0A151R9E5_CAJCA; Myb-related protein Zm1
STRINGGLYMA08G17861.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100293042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-76myb domain protein 63